PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK19195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 275aa    MW: 31892.4 Da    PI: 4.8784
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK19195.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM73.45.5e-23251511128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.....leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                lp+G+rF P+deelv +yL kkv +k+      ++ + i++ + y+  P++L +   ++e++wyfF+ +d +++  + +n   + g+Wk+  +  +++  
  PK19195.1  25 LPVGYRFIPSDEELVAFYLVKKVFDKSlpqlvATIITDISQREFYSKPPKQLVTFSPGKERQWYFFIYHDDNNS--SMQN---DLGFWKEHIEAIPIII- 118
                799************************7654323323488889*********866667889*******999754..3333...46**************. PP

        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 g++v +k + ++ +g+  k++kt+W m+ey+l
  PK19195.1 119 CGKQVATKIMRTYLSGHGLKAKKTHWEMEEYQL 151
                9999***9999999*****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-2424155IPR003441NAC domain
PROSITE profilePS5100523.86425181IPR003441NAC domain
PfamPF023653.2E-1426151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MTGRGSLPGS LPVGYRFRGS LPGSLPVGYR FIPSDEELVA FYLVKKVFDK SLPQLVATII  60
TDISQREFYS KPPKQLVTFS PGKERQWYFF IYHDDNNSSM QNDLGFWKEH IEAIPIIICG  120
KQVATKIMRT YLSGHGLKAK KTHWEMEEYQ LCQAKDIDQI ESAYGKLESD QSGKVGHIEN  180
KLENNHDRNA RSIDNTLENE HNRDNSNVDD ELEDNHNRDE STSGCESENH DLHNRDERIE  240
VDEMDIWKSE RENENVKLDN VEDEMRKGLV QIDKW
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144391218
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.13e-15NAC domain containing protein 28